PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G27930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 567aa    MW: 62696.7 Da    PI: 7.4609
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G27930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48.1e-192168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+llv++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  ORUFI07G27930.1 21 RGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYL 68
                     89********************************************97 PP

2Myb_DNA-binding51.52.2e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  ORUFI07G27930.1  74 RGNMTAEEQLLILELHGRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 117
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6681668IPR017930Myb domain
SuperFamilySSF466892.1E-3019115IPR009057Homeodomain-like
SMARTSM007173.3E-162070IPR001005SANT/Myb domain
PfamPF002491.2E-162168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-222275IPR009057Homeodomain-like
CDDcd001677.86E-132368No hitNo description
PROSITE profilePS5129423.7569123IPR017930Myb domain
SMARTSM007174.8E-1573121IPR001005SANT/Myb domain
PfamPF002494.7E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2276122IPR009057Homeodomain-like
CDDcd001675.31E-1276117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MMMAREVSSE EEAGGGDELR RGPWTVEEDL LLVNYIAAHG EGRWNALARC AGLKRTGKSC  60
RLRWLNYLRP DVRRGNMTAE EQLLILELHG RWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ  120
KHAKHLNCDV NSQQFKDLMR YLWMPRLLER IHRSSQSQSH DADDADLSVS AATSCITSDL  180
VVDAHHPPLA MADSNDSAAM WQQHQAPQMS VAGAPPPTTT MAQHVVLPTA AASCHQMQDQ  240
FVCARAAETT TCCWSESESL PGLAGLYYDD AAAALPEFDV ETMAMWGPED DPWYTQMLGL  300
SMPPPSHFPS IAVTPVWDPY QQHVVGEQQQ QVAGSSIDQP LTPFTVVCTK HSCSAALCPT  360
PKIKSHRRQE IQVQSLICFD DLQSRGCSLL IVRSLPLLFE LAHDDDSHHG DDDHDDDEGG  420
TAIKKQLLRR RRRGRRPAGG GHHAGKPVAD GLHHGPALER HRGSGSRHKL RRGGDGDGLA  480
VIAGLGIPRR RSWPLPPSSA SCCRCRRRPP AAVVCRREMG KGEERGWRKR VELTCGSHTG  540
VTAMDGKCDG GGMDPILQSS SGTQQIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-25181211103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1428435RRRRRGRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1034550.0AK103455.1 Oryza sativa Japonica Group cDNA clone:J033129J22, full insert sequence.
GenBankHQ8588210.0HQ858821.1 Oryza sativa Japonica Group isolate UT1319 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645266.10.0PREDICTED: myb-related protein 340
TrEMBLA0A0E0QD020.0A0A0E0QD02_ORYRU; Uncharacterized protein
STRINGLOC_Os07g48870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.16e-78myb domain protein 112